Lineage for d1psab_ (1psa B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61676Protein Pepsin(ogen) [50658] (4 species)
  7. 61687Species Pig (Sus scrofa) [TaxId:9823] [50659] (7 PDB entries)
  8. 61694Domain d1psab_: 1psa B: [26847]

Details for d1psab_

PDB Entry: 1psa (more details), 2.9 Å

PDB Description: structure of a pepsin(slash)renin inhibitor complex reveals a novel crystal packing induced by minor chemical alterations in the inhibitor

SCOP Domain Sequences for d1psab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psab_ b.50.1.2 (B:) Pepsin(ogen) {Pig (Sus scrofa)}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOP Domain Coordinates for d1psab_:

Click to download the PDB-style file with coordinates for d1psab_.
(The format of our PDB-style files is described here.)

Timeline for d1psab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1psaa_