| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.143: SAICAR synthase-like [56103] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) ![]() shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies |
| Family d.143.1.0: automated matches [191445] (1 protein) not a true family |
| Protein automated matches [190664] (8 species) not a true protein |
| Species Pyrococcus horikoshii OT3 [TaxId:70601] [194472] (16 PDB entries) |
| Domain d4o81a_: 4o81 A: [268469] automated match to d2z02a_ complexed with adp, amp, bu1, cd |
PDB Entry: 4o81 (more details), 2.1 Å
SCOPe Domain Sequences for d4o81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o81a_ d.143.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
akkmipidddklimefkddatafdgtkkarfkgkgwlnaqlsviffklleehgikthfig
vaggnrlivekldmyplevvvrnvvagslkkrlplpegyelpepivelyykndelhdpmi
nyyhakvlgisldeikkieeialkvneilkdylakkgiilvdfklefgkdkngdivlade
ispdtcrfwdaktkrsldkdvfrfdkgdlieaykeiyeritgekpef
Timeline for d4o81a_: