Lineage for d4o50a_ (4o50 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435297Species Trichomonas vaginalis [TaxId:5722] [195009] (12 PDB entries)
  8. 2435303Domain d4o50a_: 4o50 A: [268462]
    automated match to d3qsra_
    complexed with na; mutant

Details for d4o50a_

PDB Entry: 4o50 (more details), 1.95 Å

PDB Description: crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-ala mutant (tvag_497370)
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4o50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o50a_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
mrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfaflptlqqklrkdwkv
saenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengm
kiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastq
daqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepg
finivnsnvhsk

SCOPe Domain Coordinates for d4o50a_:

Click to download the PDB-style file with coordinates for d4o50a_.
(The format of our PDB-style files is described here.)

Timeline for d4o50a_: