![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Pepsin(ogen) [50658] (4 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50659] (8 PDB entries) |
![]() | Domain d1psaa_: 1psa A: [26846] complexed with 0zl |
PDB Entry: 1psa (more details), 2.9 Å
SCOPe Domain Sequences for d1psaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psaa_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi lgdvfirqyytvfdrannkvglapva
Timeline for d1psaa_: