Lineage for d4o7na_ (4o7n A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979411Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2979412Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2979493Family d.143.1.0: automated matches [191445] (1 protein)
    not a true family
  6. 2979494Protein automated matches [190664] (8 species)
    not a true protein
  7. 2979519Species Pyrococcus horikoshii OT3 [TaxId:70601] [194472] (16 PDB entries)
  8. 2979529Domain d4o7na_: 4o7n A: [268458]
    automated match to d2z02a_
    complexed with act, adp, mg, po4

Details for d4o7na_

PDB Entry: 4o7n (more details), 2.16 Å

PDB Description: SAICAR synthetase (Type-2) in complex with ADP
PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d4o7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o7na_ d.143.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
evyegkakkmipidddklimefkddatafdgtkkarfkgkgwlnaqlsviffklleehgi
kthfigvaggnrlivekldmyplevvvrnvvagslkkrlplpegyelpepivelyyknde
lhdpminyyhakvlgisldeikkieeialkvneilkdylakkgiilvdfklefgkdkngd
ivladeispdtcrfwdaktkrsldkdvfrfdkgdlieaykeiyeritgekpef

SCOPe Domain Coordinates for d4o7na_:

Click to download the PDB-style file with coordinates for d4o7na_.
(The format of our PDB-style files is described here.)

Timeline for d4o7na_: