SCOPe 2.05: Domain d4o32a_: 4o32 A:

Lineage for d4o32a_ (4o32 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [228276] (9 PDB entries)

8. Domain d4o32a_: 4o32 A: [268452]
   automated match to d3ul3a_
   complexed with cl

Details for d4o32a_

PDB Entry: 4o32, 2.2 Å

PDB Description: structure of a malarial protein

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4o32a_:

Sequence; same for both SEQRES and ATOM records:

>d4o32a_ c.47.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ntvivlyffakwcqactmqstemdklqkyygkriyllkvdldkneslarkfsvkslptii
llknktmlarkdhfvssndlialikkhlv

Timeline for d4o32a_:

• d4o32a_ is new in SCOPe 2.05-stable
  
• d4o32a_ is called d4o32a1 in SCOPe 2.06
  
• d4o32a_ appears in the current release, SCOPe 2.08, called d4o32a1