SCOPe 2.05: Domain d4o4wa_: 4o4w A:

Lineage for d4o4wa_ (4o4w A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (17 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [195009] (11 PDB entries)

8. Domain d4o4wa_: 4o4w A: [268451]
   automated match to d3qsra_
   complexed with na; mutant

Details for d4o4wa_

PDB Entry: 4o4w, 2.35 Å

PDB Description: crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-gly mutant (tvag_497370)

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4o4wa_:

Sequence; same for both SEQRES and ATOM records:

>d4o4wa_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
rtffvggnwkanpktveeaekliemlngakvegnvevvvaapfgflptlqqklrkdwkvs
aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk
iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd
aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepgf
inivnsnvhs

Timeline for d4o4wa_:

• d4o4wa_ is new in SCOPe 2.05-stable
  
• d4o4wa_ appears in SCOPe 2.06
  
• d4o4wa_ appears in the current release, SCOPe 2.08