SCOPe 2.08: Domain d4o32b1: 4o32 B:69-157

Lineage for d4o32b1 (4o32 B:69-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [228276] (25 PDB entries)

8. Domain d4o32b1: 4o32 B:69-157 [268450]
   Other proteins in same PDB: d4o32a2, d4o32b2, d4o32c2
   automated match to d3ul3a_
   complexed with cl

Details for d4o32b1

PDB Entry: 4o32, 2.2 Å

PDB Description: structure of a malarial protein

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4o32b1:

Sequence; same for both SEQRES and ATOM records:

>d4o32b1 c.47.1.0 (B:69-157) automated matches {Plasmodium falciparum [TaxId: 36329]}
kntvivlyffakwcqactmqstemdklqkyygkriyllkvdldkneslarkfsvkslpti
illknktmlarkdhfvssndlialikkhl

Timeline for d4o32b1:

• d4o32b1 first appeared in SCOPe 2.05, called d4o32b_
  
• d4o32b1 appears in SCOPe 2.07