Lineage for d5pep__ (5pep -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16090Protein Pepsin(ogen) [50658] (4 species)
  7. 16101Species Pig (Sus scrofa) [TaxId:9823] [50659] (7 PDB entries)
  8. 16106Domain d5pep__: 5pep - [26845]

Details for d5pep__

PDB Entry: 5pep (more details), 2.34 Å

PDB Description: x-ray analyses of aspartic proteases. ii. three-dimensional structure of the hexagonal crystal form of porcine pepsin at 2.3 angstroms resolution

SCOP Domain Sequences for d5pep__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pep__ b.50.1.2 (-) Pepsin(ogen) {Pig (Sus scrofa)}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssiaslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOP Domain Coordinates for d5pep__:

Click to download the PDB-style file with coordinates for d5pep__.
(The format of our PDB-style files is described here.)

Timeline for d5pep__: