SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4o1nb1 (4o1n B:14-101)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2051028Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2051029Protein automated matches [226834] (5 species)
    not a true protein
  7. 2051055Species Staphylococcus aureus [TaxId:93061] [226094] (7 PDB entries)
  8. 2051067Domain d4o1nb1: 4o1n B:14-101 [268438]
    Other proteins in same PDB: d4o1na2, d4o1nb2, d4o1nc2, d4o1nd2, d4o1ne2, d4o1nf2
    automated match to d1m4va1
    complexed with gol

Details for d4o1nb1

PDB Entry: 4o1n (more details), 2.5 Å

PDB Description: Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383
PDB Compounds: (B:) Superantigen-like protein

SCOPe Domain Sequences for d4o1nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1nb1 b.40.2.0 (B:14-101) automated matches {Staphylococcus aureus [TaxId: 93061]}
seselkhyynkpilerknvtgfkytdegkhylevtvgqqhsritllgsdkdkfkdgensn
idvfilregdsrqatnysiggvtksnsv

SCOPe Domain Coordinates for d4o1nb1:

Click to download the PDB-style file with coordinates for d4o1nb1.
(The format of our PDB-style files is described here.)

Timeline for d4o1nb1: