| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
| Protein automated matches [226834] (6 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries) |
| Domain d4o1na1: 4o1n A:14-101 [268436] Other proteins in same PDB: d4o1na2, d4o1nb2, d4o1nc2, d4o1nd2, d4o1ne2, d4o1nf2 automated match to d1m4va1 complexed with gol |
PDB Entry: 4o1n (more details), 2.5 Å
SCOPe Domain Sequences for d4o1na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1na1 b.40.2.0 (A:14-101) automated matches {Staphylococcus aureus [TaxId: 93061]}
seselkhyynkpilerknvtgfkytdegkhylevtvgqqhsritllgsdkdkfkdgensn
idvfilregdsrqatnysiggvtksnsv
Timeline for d4o1na1: