SCOPe 2.05: Domain d4o1fb_: 4o1f B:

Lineage for d4o1fb_ (4o1f B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.0: automated matches [191656] (1 protein)
   not a true family

6. Protein automated matches [191224] (3 species)
   not a true protein

7. Species Desulfitobacterium hafniense [TaxId:272564] [268422] (3 PDB entries)

8. Domain d4o1fb_: 4o1f B: [268429]
   automated match to d2yckx_
   complexed with thg

Details for d4o1fb_

PDB Entry: 4o1f, 1.8 Å

PDB Description: structure of a methyltransferase component in complex with thf involved in o-demethylation

PDB Compounds: (B:) Dihydropteroate synthase DHPS

SCOPe Domain Sequences for d4o1fb_:

Sequence; same for both SEQRES and ATOM records:

>d4o1fb_ c.1.21.0 (B:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
mliiigekingtipsvkkaieakdeklirdlalrqseagadyidvcastspelevetlqw
lmdivqeatdtplcidspnpraiqqvllyakrpglinsvslegdkcevifpliqgtswqv
ialtcdnsgipqdvqsrveiaqalvekaqsydiaqerihidplvialsadngallkfaea
trqikanypminvtsglsnisfgmplrkvvnqnfltlamfagmdsaildplnrdllaall
ateallgrdkhcrnfanayrknkigpl

Timeline for d4o1fb_:

• d4o1fb_ is new in SCOPe 2.05-stable
  
• d4o1fb_ is called d4o1fb1 in SCOPe 2.06
  
• d4o1fb_ appears in the current release, SCOPe 2.08, called d4o1fb1