SCOPe 2.07: Domain d4ns2a_: 4ns2 A:

Lineage for d4ns2a_ (4ns2 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 protein domains)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)

8. Domain d4ns2a_: 4ns2 A: [268416]
   automated match to d4pnja_
   complexed with hem, so4; mutant

Details for d4ns2a_

PDB Entry: 4ns2, 1.18 Å

PDB Description: Crystal structure of Horse heart ferric myoglobin; D44K/D60K/E85K mutant

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d4ns2a_:

Sequence; same for both SEQRES and ATOM records:

>d4ns2a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkasek
lkkhgtvvltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d4ns2a_:

• d4ns2a_ first appeared in SCOPe 2.05
  
• d4ns2a_ appears in SCOPe 2.06