Lineage for d4nv8a_ (4nv8 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155126Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 protein domains)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 2155151Protein automated matches [190090] (5 species)
    not a true protein
  7. 2155152Species Mesorhizobium loti [TaxId:266835] [268407] (2 PDB entries)
  8. 2155153Domain d4nv8a_: 4nv8 A: [268411]
    automated match to d2bsza1
    mutant

Details for d4nv8a_

PDB Entry: 4nv8 (more details), 1.84 Å

PDB Description: Crystal Structure of Mesorhizobium Loti Arylamine N-acetyltransferase F42W Mutant
PDB Compounds: (A:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d4nv8a_:

Sequence, based on SEQRES records: (download)

>d4nv8a_ d.3.1.5 (A:) automated matches {Mesorhizobium loti [TaxId: 266835]}
ppfdldaylarigytgprnasldtlkalhfahpqaipwenidpflgrpvrldlaalqdki
vlggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrty
iadvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpq
yevdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataa
dladtlqgllgiiipdrtafeakvretkive

Sequence, based on observed residues (ATOM records): (download)

>d4nv8a_ d.3.1.5 (A:) automated matches {Mesorhizobium loti [TaxId: 266835]}
ppfdldaylarigytgprnasldtlkalhfahpqaipwenidpflgrpvrldlaalqdki
vlggrggycfehnllfmhalkalgfevgglaarvlwgqseaitarshmllrveldgrtyi
advgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqy
evdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataad
ladtlqgllgiiipdrtafeakvretkive

SCOPe Domain Coordinates for d4nv8a_:

Click to download the PDB-style file with coordinates for d4nv8a_.
(The format of our PDB-style files is described here.)

Timeline for d4nv8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4nv8b_