Lineage for d3psg__ (3psg -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 16090Protein Pepsin(ogen) [50658] (4 species)
  7. 16101Species Pig (Sus scrofa) [TaxId:9823] [50659] (7 PDB entries)
  8. 16102Domain d3psg__: 3psg - [26841]

Details for d3psg__

PDB Entry: 3psg (more details), 1.65 Å

PDB Description: the high resolution crystal structure of porcine pepsinogen

SCOP Domain Sequences for d3psg__:

Sequence, based on SEQRES records: (download)

>d3psg__ b.50.1.2 (-) Pepsin(ogen) {Pig (Sus scrofa)}
lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
fdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgslnwvpvsvegywqitlds
itmdgetiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslp
divftidgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdra
nnkvglapva

Sequence, based on observed residues (ATOM records): (download)

>d3psg__ b.50.1.2 (-) Pepsin(ogen) {Pig (Sus scrofa)}
lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
fdnlwdqglvsqdlfsvylsgsvvllggidssyytgslnwvpvsvegywqitldsitmdg
etiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslpdivft
idgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdrannkvg
lapva

SCOP Domain Coordinates for d3psg__:

Click to download the PDB-style file with coordinates for d3psg__.
(The format of our PDB-style files is described here.)

Timeline for d3psg__: