Lineage for d3psga_ (3psg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060854Protein Pepsin(ogen) [50658] (4 species)
  7. 2060867Species Pig (Sus scrofa) [TaxId:9823] [50659] (8 PDB entries)
  8. 2060868Domain d3psga_: 3psg A: [26841]

Details for d3psga_

PDB Entry: 3psg (more details), 1.65 Å

PDB Description: the high resolution crystal structure of porcine pepsinogen
PDB Compounds: (A:) pepsinogen

SCOPe Domain Sequences for d3psga_:

Sequence, based on SEQRES records: (download)

>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
fdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgslnwvpvsvegywqitlds
itmdgetiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslp
divftidgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdra
nnkvglapva

Sequence, based on observed residues (ATOM records): (download)

>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
fdnlwdqglvsqdlfsvylsgsvvllggidssyytgslnwvpvsvegywqitldsitmdg
etiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslpdivft
idgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdrannkvg
lapva

SCOPe Domain Coordinates for d3psga_:

Click to download the PDB-style file with coordinates for d3psga_.
(The format of our PDB-style files is described here.)

Timeline for d3psga_: