Lineage for d4nota_ (4not A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042867Species Dioclea sclerocarpa [TaxId:1176036] [268405] (1 PDB entry)
  8. 2042868Domain d4nota_: 4not A: [268406]
    automated match to d2je9a_
    complexed with ca, mn, xmm

Details for d4nota_

PDB Entry: 4not (more details), 2.35 Å

PDB Description: crystal structure of dioclea sclerocarpa lectin complexed with x-man
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d4nota_:

Sequence, based on SEQRES records: (download)

>d4nota_ b.29.1.1 (A:) automated matches {Dioclea sclerocarpa [TaxId: 1176036]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adenslhfsfhkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4nota_ b.29.1.1 (A:) automated matches {Dioclea sclerocarpa [TaxId: 1176036]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnse
nslhfsfhkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvhiwe
ksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d4nota_:

Click to download the PDB-style file with coordinates for d4nota_.
(The format of our PDB-style files is described here.)

Timeline for d4nota_: