Lineage for d4ns3c1 (4ns3 C:1-543)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141353Species Mycobacterium tuberculosis [TaxId:83332] [225379] (7 PDB entries)
  8. 2141366Domain d4ns3c1: 4ns3 C:1-543 [268404]
    Other proteins in same PDB: d4ns3a2, d4ns3b2, d4ns3c2, d4ns3d2, d4ns3e2, d4ns3f2
    automated match to d4idma_
    complexed with b12, nad

Details for d4ns3c1

PDB Entry: 4ns3 (more details), 2.38 Å

PDB Description: crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad and cobalamin
PDB Compounds: (C:) Delta-1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d4ns3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ns3c1 c.82.1.0 (C:1-543) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgeridv
vqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwre
kiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpld
gfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvinl
vtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdfv
vahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdit
dlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptde
sfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaag
nfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphm
avd

SCOPe Domain Coordinates for d4ns3c1:

Click to download the PDB-style file with coordinates for d4ns3c1.
(The format of our PDB-style files is described here.)

Timeline for d4ns3c1:

  • d4ns3c1 first appeared in SCOPe 2.05, called d4ns3c_