Lineage for d1qdmb2 (1qdm B:2-247,B:248-338)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060877Protein Plant acid proteinase, phytepsin [50655] (2 species)
  7. 2060878Species Barley (Hordeum vulgare) [TaxId:4513] [50657] (1 PDB entry)
  8. 2060880Domain d1qdmb2: 1qdm B:2-247,B:248-338 [26839]
    Other proteins in same PDB: d1qdma1, d1qdmb1, d1qdmc1
    zymogen; contains propeptide at the N-terminus and swaposin domain (residues 1S-104S) inserted in between residues 247 and 248

Details for d1qdmb2

PDB Entry: 1qdm (more details), 2.3 Å

PDB Description: crystal structure of prophytepsin, a zymogen of a barley vacuolar aspartic proteinase.
PDB Compounds: (B:) prophytepsin

SCOPe Domain Sequences for d1qdmb2:

Sequence, based on SEQRES records: (download)

>d1qdmb2 b.50.1.2 (B:2-247,B:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]}
eeegdivalknymnaqyfgeigvgtppqkftvifdtgssnlwvpsakcyfsiacylhsry
kagasstykkngkpaaiqygtgsiagyfsedsvtvgdlvvkdqefieatkepgitflvak
fdgilglgfkeisvgkavpvwykmieqglvsdpvfsfwlnrhvdegeggeiifggmdpkh
yvgehtyvpvtqkgywqfdmgdvlvggkstgfcaggcaaiadsgtsllagptaiiteine
kigaagXspmgesavdcgslgsmpdieftiggkkfalkpeeyilkvgegaaaqcisgfta
mdippprgplwilgdvfmgpyhtvfdygklrigfakaa

Sequence, based on observed residues (ATOM records): (download)

>d1qdmb2 b.50.1.2 (B:2-247,B:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]}
eeegdivalknymnaqyfgeigvgtppqkftvifdtgssnlwvpsakcyfsiacylhsry
kagasstykkngkpaaiqygtgsiagyfsedsvtvgdlvvkdqefieatkepgitflvak
fdgilglgfkeisvgkavpvwykmieqglvsdpvfsfwlnrhvggeiifggmdpkhyvge
htyvpvtqkgywqfdmgdvlvggkstgfcaggcaaiadsgtsllagptaiiteinekiga
agXspmgesavdcgslgsmpdieftiggkkfalkpeeyilkvgegaaaqcisgftamdip
pprgplwilgdvfmgpyhtvfdygklrigfakaa

SCOPe Domain Coordinates for d1qdmb2:

Click to download the PDB-style file with coordinates for d1qdmb2.
(The format of our PDB-style files is described here.)

Timeline for d1qdmb2: