Lineage for d4npra1 (4npr A:19-238)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (55 species)
    not a true protein
  7. 2375168Species Aspergillus niveus [TaxId:41281] [268388] (1 PDB entry)
  8. 2375169Domain d4npra1: 4npr A:19-238 [268389]
    Other proteins in same PDB: d4npra2
    automated match to d3vl9a_
    complexed with so4

Details for d4npra1

PDB Entry: 4npr (more details), 2.5 Å

PDB Description: Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus
PDB Compounds: (A:) Xyloglucan-specific endo-beta-1,4-glucanase GH12

SCOPe Domain Sequences for d4npra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npra1 b.29.1.0 (A:19-238) automated matches {Aspergillus niveus [TaxId: 41281]}
atqfcdqwgsvtegnyilynnlwgqaqatsgsqcttfeslsgntivwntkwswsggqgqv
ksfanaalqftpkklssvksidstwkwnysgsnivadvaydmflstspggdhnyeimvwl
galggagpisstgspiatptvagikfnlylgpngsmqvysfvaqsttnsfsgdmrdffty
lesnqglssdlylvdvqagtepfsgsnavftvsdysvsva

SCOPe Domain Coordinates for d4npra1:

Click to download the PDB-style file with coordinates for d4npra1.
(The format of our PDB-style files is described here.)

Timeline for d4npra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4npra2
View in 3D
Domains from other chains:
(mouse over for more information)
d4nprb_