SCOPe 2.08: Domain d4npra1: 4npr A:19-238

Lineage for d4npra1 (4npr A:19-238)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Aspergillus niveus [TaxId:41281] [268388] (1 PDB entry)

8. Domain d4npra1: 4npr A:19-238 [268389]
   Other proteins in same PDB: d4npra2
   automated match to d3vl9a_
   complexed with so4

Details for d4npra1

PDB Entry: 4npr, 2.5 Å

PDB Description: Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus

PDB Compounds: (A:) Xyloglucan-specific endo-beta-1,4-glucanase GH12

SCOPe Domain Sequences for d4npra1:

Sequence; same for both SEQRES and ATOM records:

>d4npra1 b.29.1.0 (A:19-238) automated matches {Aspergillus niveus [TaxId: 41281]}
atqfcdqwgsvtegnyilynnlwgqaqatsgsqcttfeslsgntivwntkwswsggqgqv
ksfanaalqftpkklssvksidstwkwnysgsnivadvaydmflstspggdhnyeimvwl
galggagpisstgspiatptvagikfnlylgpngsmqvysfvaqsttnsfsgdmrdffty
lesnqglssdlylvdvqagtepfsgsnavftvsdysvsva

Timeline for d4npra1:

• d4npra1 first appeared in SCOPe 2.05, called d4npra_
  
• d4npra1 appears in SCOPe 2.07