Lineage for d4nnma_ (4nnm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786564Domain d4nnma_: 4nnm A: [268387]
    Other proteins in same PDB: d4nnmb2
    automated match to d3dj1a_
    complexed with gol

Details for d4nnma_

PDB Entry: 4nnm (more details), 1.6 Å

PDB Description: tax-interacting protein-1 (tip-1) pdz domain bound to y-ical36 (yptsii) peptide
PDB Compounds: (A:) tax1-binding protein 3

SCOPe Domain Sequences for d4nnma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnma_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeia
glqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq

SCOPe Domain Coordinates for d4nnma_:

Click to download the PDB-style file with coordinates for d4nnma_.
(The format of our PDB-style files is described here.)

Timeline for d4nnma_: