Lineage for d4mv3a1 (4mv3 A:1-114)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1843027Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1843028Protein automated matches [226903] (28 species)
    not a true protein
  7. 1843080Species Haemophilus influenzae [TaxId:71421] [268351] (8 PDB entries)
  8. 1843082Domain d4mv3a1: 4mv3 A:1-114 [268374]
    Other proteins in same PDB: d4mv3a2, d4mv3a3
    automated match to d3rv3a1
    complexed with acp, bct, edo

Details for d4mv3a1

PDB Entry: 4mv3 (more details), 1.69 Å

PDB Description: crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and bicarbonate
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4mv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mv3a1 c.30.1.0 (A:1-114) automated matches {Haemophilus influenzae [TaxId: 71421]}
mlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaksy
lnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmg

SCOPe Domain Coordinates for d4mv3a1:

Click to download the PDB-style file with coordinates for d4mv3a1.
(The format of our PDB-style files is described here.)

Timeline for d4mv3a1: