Lineage for d4mv4a3 (4mv4 A:331-445)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082834Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2082959Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2082960Protein automated matches [254496] (13 species)
    not a true protein
  7. 2082986Species Haemophilus influenzae [TaxId:71421] [268355] (8 PDB entries)
  8. 2082987Domain d4mv4a3: 4mv4 A:331-445 [268373]
    Other proteins in same PDB: d4mv4a1, d4mv4a2
    automated match to d2w6za3
    complexed with acp, cl, edo, mg

Details for d4mv4a3

PDB Entry: 4mv4 (more details), 1.61 Å

PDB Description: crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4mv4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mv4a3 b.84.2.0 (A:331-445) automated matches {Haemophilus influenzae [TaxId: 71421]}
kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklg

SCOPe Domain Coordinates for d4mv4a3:

Click to download the PDB-style file with coordinates for d4mv4a3.
(The format of our PDB-style files is described here.)

Timeline for d4mv4a3: