Lineage for d4mv4a2 (4mv4 A:115-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928777Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1928778Protein automated matches [226904] (27 species)
    not a true protein
  7. 1928826Species Haemophilus influenzae [TaxId:71421] [268353] (8 PDB entries)
  8. 1928827Domain d4mv4a2: 4mv4 A:115-330 [268372]
    Other proteins in same PDB: d4mv4a1, d4mv4a3
    automated match to d1dv2a3
    complexed with acp, cl, edo, mg

Details for d4mv4a2

PDB Entry: 4mv4 (more details), 1.61 Å

PDB Description: crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4mv4a2:

Sequence, based on SEQRES records: (download)

>d4mv4a2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]}
dkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiikasgggggrgmrvvrs
edaleesiamtkaeakaafnndmvymekylenprhveiqvladthgnavylaerdcsmqr
rhqkvveeapapgiteevrrdigsrcanacveigyrgagtfeflyengefyfiemntriq
vehpvtemitgvdlvkeqlriaaglpisfkqedikv

Sequence, based on observed residues (ATOM records): (download)

>d4mv4a2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]}
dkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiikasggggmrvvrseda
leesiamtkaeakaafnndmvymekylenprhveiqvladthgnavylaerdcsmqrrhq
kvveeapapgiteevrrdigsrcanacveigyrgagtfeflyengefyfiemntriqveh
pvtemitgvdlvkeqlriaaglpisfkqedikv

SCOPe Domain Coordinates for d4mv4a2:

Click to download the PDB-style file with coordinates for d4mv4a2.
(The format of our PDB-style files is described here.)

Timeline for d4mv4a2: