![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) ![]() automatically mapped to Pfam PF09055 |
![]() | Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
![]() | Protein automated matches [191040] (1 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [188872] (4 PDB entries) |
![]() | Domain d4ncqc_: 4ncq C: [268370] automated match to d1t6ua_ mutant |
PDB Entry: 4ncq (more details), 2.08 Å
SCOPe Domain Sequences for d4ncqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ncqc_ a.24.22.1 (C:) automated matches {Streptomyces coelicolor [TaxId: 1902]} vydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpph fekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkk
Timeline for d4ncqc_: