Lineage for d1b5f.2 (1b5f C:,D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060877Protein Plant acid proteinase, phytepsin [50655] (2 species)
  7. 2060882Species Cynara cardunculus [TaxId:4265] [50656] (1 PDB entry)
  8. 2060884Domain d1b5f.2: 1b5f C:,D: [26837]

Details for d1b5f.2

PDB Entry: 1b5f (more details), 1.72 Å

PDB Description: native cardosin a from cynara cardunculus l.
PDB Compounds: (C:) protein (cardosin a), (D:) protein (cardosin a)

SCOPe Domain Sequences for d1b5f.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1b5f.2 b.50.1.2 (C:,D:) Plant acid proteinase, phytepsin {Cynara cardunculus [TaxId: 4265]}
savvaltndrdtsyfgeigigtppqkftvifdtgssvlwvpsskcinskacrahsmyess
dsstykengtfgaiiygtgsitgffsqdsvtigdlvvkeqdfieatdeadnvflhrlfdg
ilglsfqtisvpvwynmlnqglvkerrfsfwlnrnvdeeeggelvfggldpnhfrgdhty
vpvtyqyywqfgigdvligdkstgfcapgcqafadsgtsllsgptaivtqinhaiganXe
elqvdcntlssmpnvsftiggkkfgltpeqyilkvgkgeatqcisgftamdatllgplwi
lgdvfmrpyhtvfdygnllvgfaeaa

SCOPe Domain Coordinates for d1b5f.2:

Click to download the PDB-style file with coordinates for d1b5f.2.
(The format of our PDB-style files is described here.)

Timeline for d1b5f.2: