![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
![]() | Protein automated matches [254496] (16 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:71421] [268355] (10 PDB entries) |
![]() | Domain d4mv9a3: 4mv9 A:331-445 [268366] Other proteins in same PDB: d4mv9a1, d4mv9a2 automated match to d2w6za3 complexed with bct, edo |
PDB Entry: 4mv9 (more details), 1.98 Å
SCOPe Domain Sequences for d4mv9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mv9a3 b.84.2.0 (A:331-445) automated matches {Haemophilus influenzae [TaxId: 71421]} kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklg
Timeline for d4mv9a3: