![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (39 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:71421] [268353] (10 PDB entries) |
![]() | Domain d4mv7a2: 4mv7 A:115-330 [268362] Other proteins in same PDB: d4mv7a1, d4mv7a3 automated match to d1dv2a3 complexed with edo, ppf |
PDB Entry: 4mv7 (more details), 1.73 Å
SCOPe Domain Sequences for d4mv7a2:
Sequence, based on SEQRES records: (download)
>d4mv7a2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]} dkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiikasgggggrgmrvvrs edaleesiamtkaeakaafnndmvymekylenprhveiqvladthgnavylaerdcsmqr rhqkvveeapapgiteevrrdigsrcanacveigyrgagtfeflyengefyfiemntriq vehpvtemitgvdlvkeqlriaaglpisfkqedikv
>d4mv7a2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]} dkvsaikamkkagvpcvpgsaknkeiakrigypiiirvvrsedaleesiamtkaemekyl enprhveiqvladthgnavylaerdcsmqrrhqkvveeapapgiteevrrdigsrcanac veigyrgagtfeflyengefyfiemntriqvehpvtemitgvdlvkeqlriaaglpisfk qedikv
Timeline for d4mv7a2: