Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (28 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [268351] (8 PDB entries) |
Domain d4mv7a1: 4mv7 A:1-114 [268361] Other proteins in same PDB: d4mv7a2, d4mv7a3 automated match to d3rv3a1 complexed with edo, ppf |
PDB Entry: 4mv7 (more details), 1.73 Å
SCOPe Domain Sequences for d4mv7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mv7a1 c.30.1.0 (A:1-114) automated matches {Haemophilus influenzae [TaxId: 71421]} mlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaksy lnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmg
Timeline for d4mv7a1: