| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (11 species) not a true protein |
| Species Haemophilus influenzae [TaxId:71421] [268355] (8 PDB entries) |
| Domain d4mv8a3: 4mv8 A:331-446 [268356] Other proteins in same PDB: d4mv8a1, d4mv8a2 automated match to d2w6za3 complexed with acp, po4 |
PDB Entry: 4mv8 (more details), 2.06 Å
SCOPe Domain Sequences for d4mv8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mv8a3 b.84.2.0 (A:331-446) automated matches {Haemophilus influenzae [TaxId: 71421]}
kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklgm
Timeline for d4mv8a3: