Lineage for d4ncqa_ (4ncq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700648Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. 2700649Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. 2700725Protein automated matches [191040] (1 species)
    not a true protein
  7. 2700726Species Streptomyces coelicolor [TaxId:1902] [188872] (4 PDB entries)
  8. 2700736Domain d4ncqa_: 4ncq A: [268350]
    automated match to d1t6ua_
    mutant

Details for d4ncqa_

PDB Entry: 4ncq (more details), 2.08 Å

PDB Description: crystal structure of nisod h1a mutant
PDB Compounds: (A:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d4ncqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ncqa_ a.24.22.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
cgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkp
phfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka

SCOPe Domain Coordinates for d4ncqa_:

Click to download the PDB-style file with coordinates for d4ncqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ncqa_: