Lineage for d4mlrg_ (4mlr G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836178Species Campylobacter jejuni [TaxId:197] [189316] (3 PDB entries)
  8. 2836189Domain d4mlrg_: 4mlr G: [268340]
    automated match to d3m5vb_
    complexed with act, edo, gol, lys, pg4, pge; mutant

Details for d4mlrg_

PDB Entry: 4mlr (more details), 2.2 Å

PDB Description: dihydrodipicolinate synthase from c. jejuni, y110f mutation with pyruvate and lysine
PDB Compounds: (G:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4mlrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlrg_ c.1.10.0 (G:) automated matches {Campylobacter jejuni [TaxId: 197]}
kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc
ieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapfynkptqqglyeh
ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe
prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn
inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d4mlrg_:

Click to download the PDB-style file with coordinates for d4mlrg_.
(The format of our PDB-style files is described here.)

Timeline for d4mlrg_: