SCOPe 2.06: Domain d1fq8a_: 1fq8 A:

Lineage for d1fq8a_ (1fq8 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (12 PDB entries)
   synonym: saccharopepsin

8. Domain d1fq8a_: 1fq8 A: [26834]
   complexed with 2y4, nag

Details for d1fq8a_

PDB Entry: 1fq8, 2.8 Å

PDB Description: x-ray structure of difluorostatine inhibitor cp81,198 bound to saccharopepsin

PDB Compounds: (A:) saccharopepsin

SCOPe Domain Sequences for d1fq8a_:

Sequence; same for both SEQRES and ATOM records:

>d1fq8a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai

Timeline for d1fq8a_:

• d1fq8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fq8a_ appears in SCOPe 2.05
  
• d1fq8a_ appears in SCOPe 2.07
  
• d1fq8a_ appears in the current release, SCOPe 2.08