Lineage for d1fq8a_ (1fq8 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466919Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (11 PDB entries)
    synonym: saccharopepsin
  8. 466929Domain d1fq8a_: 1fq8 A: [26834]

Details for d1fq8a_

PDB Entry: 1fq8 (more details), 2.8 Å

PDB Description: x-ray structure of difluorostatine inhibitor cp81,198 bound to saccharopepsin

SCOP Domain Sequences for d1fq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq8a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai

SCOP Domain Coordinates for d1fq8a_:

Click to download the PDB-style file with coordinates for d1fq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq8a_: