| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Campylobacter jejuni [TaxId:197] [189316] (3 PDB entries) |
| Domain d4mlja_: 4mlj A: [268336] automated match to d3m5vb_ complexed with edo, pg4, pge; mutant |
PDB Entry: 4mlj (more details), 2.3 Å
SCOPe Domain Sequences for d4mlja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mlja_ c.1.10.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
niiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtci
eiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapfynkptqqglyehy
kaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahep
rmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyni
nkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d4mlja_: