Lineage for d4mlja_ (4mlj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836178Species Campylobacter jejuni [TaxId:197] [189316] (3 PDB entries)
  8. 2836191Domain d4mlja_: 4mlj A: [268336]
    automated match to d3m5vb_
    complexed with edo, pg4, pge; mutant

Details for d4mlja_

PDB Entry: 4mlj (more details), 2.3 Å

PDB Description: dihydrodipicolinate synthase from c. jejuni, y110f mutation with pyruvate bound to the active site
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4mlja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlja_ c.1.10.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
niiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtci
eiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapfynkptqqglyehy
kaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahep
rmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyni
nkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d4mlja_:

Click to download the PDB-style file with coordinates for d4mlja_.
(The format of our PDB-style files is described here.)

Timeline for d4mlja_: