SCOPe 2.07: Domain d4mljb_: 4mlj B:

Lineage for d4mljb_ (4mlj B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [189316] (3 PDB entries)

8. Domain d4mljb_: 4mlj B: [268335]
   automated match to d3m5vb_
   complexed with edo, pg4, pge; mutant

Details for d4mljb_

PDB Entry: 4mlj, 2.3 Å

PDB Description: dihydrodipicolinate synthase from c. jejuni, y110f mutation with pyruvate bound to the active site

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4mljb_:

Sequence; same for both SEQRES and ATOM records:

>d4mljb_ c.1.10.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapfynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

Timeline for d4mljb_:

• d4mljb_ first appeared in SCOPe 2.05
  
• d4mljb_ appears in SCOPe 2.06
  
• d4mljb_ appears in the current release, SCOPe 2.08