Lineage for d4m24a_ (4m24 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820832Species Uncultured bacterium [TaxId:77133] [188624] (9 PDB entries)
  8. 1820834Domain d4m24a_: 4m24 A: [268334]
    automated match to d4ee9a_
    complexed with cbi, trs

Details for d4m24a_

PDB Entry: 4m24 (more details), 1.39 Å

PDB Description: crystal structure of the endo-1,4-glucanase, rbcel1, in complex with cellobiose
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d4m24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m24a_ c.1.8.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
wqghdalfaydimnepygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
allkkyaakdncsdfgpakae

SCOPe Domain Coordinates for d4m24a_:

Click to download the PDB-style file with coordinates for d4m24a_.
(The format of our PDB-style files is described here.)

Timeline for d4m24a_: