SCOP 1.69: Domain d1fq6a_: 1fq6 A:

Lineage for d1fq6a_ (1fq6 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (11 PDB entries)
   synonym: saccharopepsin

8. Domain d1fq6a_: 1fq6 A: [26833]

Details for d1fq6a_

PDB Entry: 1fq6, 2.7 Å

PDB Description: x-ray structure of glycol inhibitor pd-133,450 bound to saccharopepsin

SCOP Domain Sequences for d1fq6a_:

Sequence; same for both SEQRES and ATOM records:

>d1fq6a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai

Timeline for d1fq6a_:

• d1fq6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fq6a_ appears in SCOP 1.67
  
• d1fq6a_ appears in SCOP 1.71
  
• d1fq6a_ appears in the current release, SCOPe 2.08