SCOPe 2.05: Domain d4ly8a_: 4ly8 A:

Lineage for d4ly8a_ (4ly8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [268320] (3 PDB entries)

8. Domain d4ly8a_: 4ly8 A: [268321]
   automated match to d3m5vb_
   complexed with act, edo, gol, pg4, pge

Details for d4ly8a_

PDB Entry: 4ly8, 1.7 Å

PDB Description: dihydrodipicolinate synthase from C. jejuni with pyruvate bound to the active site

PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d4ly8a_:

Sequence; same for both SEQRES and ATOM records:

>d4ly8a_ c.1.10.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

Timeline for d4ly8a_:

• d4ly8a_ is new in SCOPe 2.05-stable
  
• d4ly8a_ appears in SCOPe 2.06
  
• d4ly8a_ appears in the current release, SCOPe 2.08