Lineage for d1fq4a_ (1fq4 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61570Protein Acid protease [50649] (7 species)
  7. 61571Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (9 PDB entries)
  8. 61577Domain d1fq4a_: 1fq4 A: [26832]

Details for d1fq4a_

PDB Entry: 1fq4 (more details), 2.7 Å

PDB Description: crystal structure of a complex between hydroxyethylene inhibitor cp- 108,420 and yeast aspartic proteinase a

SCOP Domain Sequences for d1fq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq4a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai

SCOP Domain Coordinates for d1fq4a_:

Click to download the PDB-style file with coordinates for d1fq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq4a_: