SCOPe 2.06: Domain d4kbqb_: 4kbq B:

Lineage for d4kbqb_ (4kbq B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)

8. Domain d4kbqb_: 4kbq B: [268315]
   Other proteins in same PDB: d4kbqc1, d4kbqc2, d4kbqd1, d4kbqd2
   automated match to d2vyib_

Details for d4kbqb_

PDB Entry: 4kbq, 2.91 Å

PDB Description: structure of the chip-tpr domain in complex with the hsc70 lid-tail domains

PDB Compounds: (B:) E3 ubiquitin-protein ligase CHIP

SCOPe Domain Sequences for d4kbqb_:

Sequence; same for both SEQRES and ATOM records:

>d4kbqb_ a.118.8.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwn

Timeline for d4kbqb_:

• d4kbqb_ first appeared in SCOPe 2.05
  
• d4kbqb_ appears in SCOPe 2.07
  
• d4kbqb_ appears in the current release, SCOPe 2.08