Class b: All beta proteins [48724] (144 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.2: Pepsin-like [50646] (10 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (11 PDB entries) synonym: saccharopepsin |
Domain d2jxra_: 2jxr A: [26831] |
PDB Entry: 2jxr (more details), 2.4 Å
SCOP Domain Sequences for d2jxra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jxra_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A} gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp laivgdaflrkyysiydignnavglakai
Timeline for d2jxra_: