Lineage for d4itgb_ (4itg B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503396Protein Cystathionine beta-lyase, CBL [53403] (2 species)
  7. 2503397Species Escherichia coli [TaxId:562] [53404] (6 PDB entries)
  8. 2503405Domain d4itgb_: 4itg B: [268297]
    automated match to d1cl1b_
    complexed with epe; mutant

Details for d4itgb_

PDB Entry: 4itg (more details), 1.74 Å

PDB Description: p113s mutant of e. coli cystathionine beta-lyase metc
PDB Compounds: (B:) Cystathionine beta-lyase MetC

SCOPe Domain Sequences for d4itgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4itgb_ c.67.1.3 (B:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]}
kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayessqdfcskils
klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
idfsgtlirlhigledvddliadldagfariv

SCOPe Domain Coordinates for d4itgb_:

Click to download the PDB-style file with coordinates for d4itgb_.
(The format of our PDB-style files is described here.)

Timeline for d4itgb_: