Lineage for d4itxa_ (4itx A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147545Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2147584Protein Cystathionine beta-lyase, CBL [53403] (2 species)
  7. 2147585Species Escherichia coli [TaxId:562] [53404] (6 PDB entries)
  8. 2147590Domain d4itxa_: 4itx A: [268294]
    automated match to d1cl1b_
    complexed with ca, in5; mutant

Details for d4itxa_

PDB Entry: 4itx (more details), 1.61 Å

PDB Description: p113s mutant of e. coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p
PDB Compounds: (A:) Cystathionine beta-lyase MetC

SCOPe Domain Sequences for d4itxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4itxa_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]}
kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayessqdfcskilsk
lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
dfsgtlirlhigledvddliadldagfariv

SCOPe Domain Coordinates for d4itxa_:

Click to download the PDB-style file with coordinates for d4itxa_.
(The format of our PDB-style files is described here.)

Timeline for d4itxa_: