Lineage for d1dp5a_ (1dp5 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1549491Protein Acid protease [50649] (9 species)
  7. 1549492Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (11 PDB entries)
    synonym: saccharopepsin
  8. 1549495Domain d1dp5a_: 1dp5 A: [26829]
    Other proteins in same PDB: d1dp5b_
    mutant

Details for d1dp5a_

PDB Entry: 1dp5 (more details), 2.2 Å

PDB Description: the structure of proteinase a complexed with a ia3 mutant inhibitor
PDB Compounds: (A:) proteinase a

SCOPe Domain Sequences for d1dp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp5a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydlgnnavglakai

SCOPe Domain Coordinates for d1dp5a_:

Click to download the PDB-style file with coordinates for d1dp5a_.
(The format of our PDB-style files is described here.)

Timeline for d1dp5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dp5b_