Lineage for d1dp5a_ (1dp5 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 15990Protein Acid protease [50649] (5 species)
  7. 15991Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (8 PDB entries)
  8. 15993Domain d1dp5a_: 1dp5 A: [26829]
    Other proteins in same PDB: d1dp5b_

Details for d1dp5a_

PDB Entry: 1dp5 (more details), 2.2 Å

PDB Description: the structure of proteinase a complexed with a ia3 mutant inhibitor

SCOP Domain Sequences for d1dp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp5a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydlgnnavglakai

SCOP Domain Coordinates for d1dp5a_:

Click to download the PDB-style file with coordinates for d1dp5a_.
(The format of our PDB-style files is described here.)

Timeline for d1dp5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dp5b_