SCOPe 2.08: Domain d4d4pc_: 4d4p C:

Lineage for d4d4pc_ (4d4p C:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.17: CSL zinc finger [144217] (2 families)

5. Family g.41.17.0: automated matches [268284] (1 protein)
   not a true family

6. Protein automated matches [268285] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [268286] (2 PDB entries)

8. Domain d4d4pc_: 4d4p C: [268288]
   automated match to d1ywsa1
   complexed with fe, so4

Details for d4d4pc_

PDB Entry: 4d4p, 3 Å

PDB Description: crystal structure of the kti11 kti13 heterodimer spacegroup p65

PDB Compounds: (C:) protein ats1, diphthamide biosynthesis protein 3

SCOPe Domain Sequences for d4d4pc_:

Sequence; same for both SEQRES and ATOM records:

>d4d4pc_ g.41.17.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfd
kedlaeyyeeagihpp

Timeline for d4d4pc_:

• d4d4pc_ first appeared in SCOPe 2.05
  
• d4d4pc_ appears in SCOPe 2.07