Lineage for d4d4oc_ (4d4o C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037409Superfamily g.41.17: CSL zinc finger [144217] (2 families) (S)
  5. 3037423Family g.41.17.0: automated matches [268284] (1 protein)
    not a true family
  6. 3037424Protein automated matches [268285] (1 species)
    not a true protein
  7. 3037425Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [268286] (2 PDB entries)
  8. 3037426Domain d4d4oc_: 4d4o C: [268287]
    automated match to d1ywsa1
    complexed with fe, so4

Details for d4d4oc_

PDB Entry: 4d4o (more details), 2.9 Å

PDB Description: crystal structure of the kti11 kti13 heterodimer spacegroup p64
PDB Compounds: (C:) protein ats1, diphthamide biosynthesis protein 3

SCOPe Domain Sequences for d4d4oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d4oc_ g.41.17.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfd
kedlaeyyeeagihp

SCOPe Domain Coordinates for d4d4oc_:

Click to download the PDB-style file with coordinates for d4d4oc_.
(The format of our PDB-style files is described here.)

Timeline for d4d4oc_: