| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.17: CSL zinc finger [144217] (2 families) ![]() |
| Family g.41.17.0: automated matches [268284] (1 protein) not a true family |
| Protein automated matches [268285] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [268286] (2 PDB entries) |
| Domain d4d4oc_: 4d4o C: [268287] automated match to d1ywsa1 complexed with fe, so4 |
PDB Entry: 4d4o (more details), 2.9 Å
SCOPe Domain Sequences for d4d4oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d4oc_ g.41.17.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfd
kedlaeyyeeagihp
Timeline for d4d4oc_: