Class b: All beta proteins [48724] (144 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.2: Pepsin-like [50646] (10 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Yeast (Candida albicans) [TaxId:5476] [50653] (2 PDB entries) |
Domain d1zap__: 1zap - [26827] |
PDB Entry: 1zap (more details), 2.5 Å
SCOP Domain Sequences for d1zap__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zap__ b.50.1.2 (-) Acid protease {Yeast (Candida albicans)} qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng kltqdsngnsyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdvn kanilgdnflrsayivydlddneisiaqvkytsasstsalt
Timeline for d1zap__: