Lineage for d1zap__ (1zap -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (5 species) 
Species Yeast (Candida albicans) [TaxId:5476] [50653] (2 PDB entries) 
Domain d1zap__: 1zap - [26827]
Details for d1zap__
PDB Entry: 1zap (more details), 2.5 Å
PDB Description: secreted aspartic protease from c. albicans
SCOP Domain Sequences for d1zap__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zap__ b.50.1.2 (-) Acid protease {Yeast (Candida albicans)}
qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck
qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys
gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
kltqdsngnsyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdvn
kanilgdnflrsayivydlddneisiaqvkytsasstsalt
SCOP Domain Coordinates for d1zap__:
Click to download the PDB-style file with coordinates for d1zap__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zap__:
- d1zap__ appears in SCOP 1.57
- d1zap__ appears in the current release, SCOPe 2.08, called d1zapa_
View in 3D