Lineage for d1zap__ (1zap -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 15990Protein Acid protease [50649] (5 species)
  7. 16024Species Yeast (Candida albicans) [TaxId:5476] [50653] (2 PDB entries)
  8. 16026Domain d1zap__: 1zap - [26827]

Details for d1zap__

PDB Entry: 1zap (more details), 2.5 Å

PDB Description: secreted aspartic protease from c. albicans

SCOP Domain Sequences for d1zap__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zap__ b.50.1.2 (-) Acid protease {Yeast (Candida albicans)}
qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck
qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys
gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
kltqdsngnsyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdvn
kanilgdnflrsayivydlddneisiaqvkytsasstsalt

SCOP Domain Coordinates for d1zap__:

Click to download the PDB-style file with coordinates for d1zap__.
(The format of our PDB-style files is described here.)

Timeline for d1zap__: